PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10017039m
Common NameCARUB_v10017039mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 514aa    MW: 56242.9 Da    PI: 8.326
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10017039mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY107.66e-34249305259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      dDgynWrKYGqK+vkgs+fprsYY+Ct++ Cpvkkkvers  d++v+ei+Y+g+Hnhe
  Carubv10017039m 249 DDGYNWRKYGQKQVKGSDFPRSYYKCTHTACPVKKKVERSL-DGQVTEIIYKGQHNHE 305
                      8****************************************.***************7 PP

2WRKY105.13.6e-33414472159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK+vkg+++prsYY+Ct++ C v+k+ver+a+dpk+v++tYeg+Hnh+
  Carubv10017039m 414 LDDGYRWRKYGQKVVKGNPYPRSYYKCTTPACGVRKHVERAANDPKAVVTTYEGKHNHD 472
                      59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.6E-29239307IPR003657WRKY domain
PROSITE profilePS5081124.237243307IPR003657WRKY domain
SuperFamilySSF1182905.75E-26246307IPR003657WRKY domain
SMARTSM007746.4E-37248306IPR003657WRKY domain
PfamPF031066.6E-26249305IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.9E-36399474IPR003657WRKY domain
SuperFamilySSF1182903.27E-29406474IPR003657WRKY domain
PROSITE profilePS5081137.39409474IPR003657WRKY domain
SMARTSM007746.9E-38414473IPR003657WRKY domain
PfamPF031061.6E-25415472IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 514 aa     Download sequence    Send to blast
MAENKQEKEQ PTKLKPSTGV SRPTISLPPR PFGEMFFSGG VGFSPGPMTL VSNLFSDPDE  60
FKSFSHLLAG AMASPAAAAV AVVATAHHQT PVSSVGDGGG SGGDVVDPRF KQNRPTGLMI  120
TQPPGMFTVP PGLSPATLLD SPSFFGLFSP LQGAFGMTHQ QALAQVTAQA VQGNNVHFQQ  180
SESEYPSSIQ QEQQQQPQTS LTENQSFSTG HRSQVPAPVQ DSSQGQRETS DISVSEHRSQ  240
PQNADKPADD GYNWRKYGQK QVKGSDFPRS YYKCTHTACP VKKKVERSLD GQVTEIIYKG  300
QHNHELPQKR GNNNGSSKNS DTATQFQTSN SNLSKTKRDQ ETSQVTTTEQ MSEASDSEEV  360
GNAETSVGEK HEDEPDAKRR NTEVRVTEPV VASSHKTVTE PRIIVQTRSE VDLLDDGYRW  420
RKYGQKVVKG NPYPRSYYKC TTPACGVRKH VERAANDPKA VVTTYEGKHN HDVPAARTSS  480
HQLRPNNQHN TSTGNFNQQQ PVARLRLKEE QIS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-43249475878Probable WRKY transcription factor 4
2lex_A3e-43249475878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00260DAPTransfer from AT2G03340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2247010.0AF224701.1 Arabidopsis thaliana WRKY DNA-binding protein 3 (WRKY3) mRNA, complete cds.
GenBankAK2290360.0AK229036.1 Arabidopsis thaliana mRNA for putative WRKY DNA-binding protein, complete cds, clone: RAFL16-33-J05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006290926.10.0hypothetical protein CARUB_v10017039mg
SwissprotQ9ZQ700.0WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLR0H3G80.0R0H3G8_9BRAS; Uncharacterized protein
STRINGAT2G03340.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15342792
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.10.0WRKY DNA-binding protein 3